GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products

(3) wood cuts,sublimation and crafts | Facebook

Product Details
Mystery MDF wood cuts packs sold in packs of 50 7cm-10cm £15 a box
Mystery MDF wood cuts packs sold in packs of 50 7cm-10cm £15 a box
Mystery MDF wood cuts packs sold in packs of 50 7cm-10cm £15 a box
Mystery MDF wood cuts packs sold in packs of 50 7cm-10cm £15 a box
Mystery MDF wood cuts packs sold in packs of 50 7cm-10cm £15 a box
Product Code:TKQE0dx
Product Condition:New
£15.00 inc. tax
Add to Cart
Description
Mystery MDF wood cuts packs sold in packs of 50
7cm-10cm
a good variety of mdf cuts per pack

https://www.facebook.com/groups/www.woodblanks.co.uk

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i