GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products

(3) wood cuts,sublimation and crafts | Facebook

Product Details
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur
Product Code:JLihxwG
Product Condition:New
£15.00 inc. tax
Add to Cart
Description
£15 A BOX FANTASTIC SELLERS Box of 25 Positive pets ,assorted faux fur assorted sizes each one is unique comes with tag sizes range from 6cm to 15cm “BUT IT IS LUCKY DIP” POSTAGE FREE

https://www.facebook.com/groups/www.woodblanks.co.uk

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i